|
HS Code |
492691 |
| product_name | Pancreastatin & Related Peptides |
| synonyms | PST, CHGA peptides |
| molecular_formula | Varies by peptide |
| sequence_origin | Derived from chromogranin A |
| source | Synthetic or animal-derived |
| purity | Typically >95% (HPLC) |
| appearance | White to off-white powder |
| storage_temperature | -20°C |
| solubility | Soluble in water or buffer |
| application | Biochemical and physiological research |
| CAS_number | Varies depending on peptide |
| molecular_weight | Varies by specific sequence |
| form | Lyophilized powder |
| shipping_conditions | Shipped at ambient temperature |
| stability | Stable for at least 1 year at -20°C |
As an accredited Pancreastatin & Related Peptides factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | White, screw-cap vial containing 1 mg lyophilized Pancreastatin & Related Peptides, labeled with product name, lot number, and storage instructions. |
| Shipping | Pancreastatin & Related Peptides are shipped in compliance with international regulations for biological and chemical substances. They are typically delivered in lyophilized form, sealed in vials, and packed with cold packs or dry ice to maintain stability. Shipping is expedited, temperature-controlled, and tracked to ensure product integrity and prompt delivery. |
| Storage | Pancreastatin & Related Peptides should be stored at -20°C in a tightly sealed container, protected from light and moisture. Avoid repeated freeze-thaw cycles to maintain peptide stability and bioactivity. If in solution, aliquot and store at -20°C or lower. Ensure proper labeling and maintain inventory records in a designated, secure peptide storage area. |
| Purity 98%: Pancreastatin & Related Peptides with purity 98% is used in endocrine research studies, where elevated purity ensures consistent receptor binding assays. Molecular Weight 4.5 kDa: Pancreastatin & Related Peptides with molecular weight 4.5 kDa is used in peptide hormone signaling investigations, where defined size enables precise biochemical pathway analysis. Stability Temperature 4°C: Pancreastatin & Related Peptides with stability temperature 4°C is used in pharmacological storage conditions, where cold stability maintains bioactivity during experimental handling. Acetate Salt Form: Pancreastatin & Related Peptides in acetate salt form is used in cell culture experiments, where optimal solubility facilitates accurate dosage administration. High Peptide Sequence Homology: Pancreastatin & Related Peptides with high peptide sequence homology is used in evolutionary biology studies, where sequence conservation enables comparative functional analyses. Peptide Concentration 1 mg/mL: Pancreastatin & Related Peptides at peptide concentration 1 mg/mL is used in metabolic studies, where standardized concentration supports reproducible inhibition assays. Batch-to-Batch Consistency: Pancreastatin & Related Peptides with batch-to-batch consistency is used in immunological assay development, where performance uniformity reduces variability in experimental results. Endotoxin Level < 0.1 EU/µg: Pancreastatin & Related Peptides with endotoxin level below 0.1 EU/µg is used in in vivo animal studies, where low endotoxin content minimizes immunogenic response interference. Lyophilized Powder: Pancreastatin & Related Peptides in lyophilized powder form is used in long-term peptide storage, where desiccated format preserves structural integrity and potency. HPLC Purification: Pancreastatin & Related Peptides purified by HPLC is used in proteomic quantification experiments, where high purity enhances detection sensitivity. |
Competitive Pancreastatin & Related Peptides prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please call us at +8615371019725 or mail to admin@sinochem-nanjing.com.
We will respond to you as soon as possible.
Tel: +8615371019725
Email: admin@sinochem-nanjing.com
Flexible payment, competitive price, premium service - Inquire now!
Decades of synthesis work have shown how the right peptide can unlock new answers in biology. Pancreastatin belongs to the chromogranin A family, presenting a unique amino acid sequence that impacts sugar metabolism and hormone regulation in a way few other peptides do. Through advanced technology, we synthesize Pancreastatin in high purity, providing researchers with precise building blocks for their discovery work. The peptide often carries the standard human sequence—human Pancreastatin 250–301 (HSDAVFTDNYTRLREDGDYQQLAEDGDGKASR)—for robust compatibility with models across physiology, endocrinology, and cell signaling.
We have worked with academic and pharmaceutical partners who rely on consistent batches, demanding full peptide chain integrity and very tight control over sequence modifications. By using solid-phase synthesis with HPLC purification, we ensure the end product reaches purities beyond 98 percent, with rigorous endotoxin testing. This purity level becomes the difference between ambiguous and reliable research data, especially for teams mapping receptor-ligand interactions or signaling cascades.
Since the first reports linking Pancreastatin to the inhibition of glucose-stimulated insulin release, demand from diabetes and metabolic disorder researchers has grown. Pancreastatin’s sequence differs from other chromogranin A peptides such as Vasostatin and Catestatin, not just in structure, but in the receptors it targets and the biological responses it triggers. For instance, unlike Catestatin that modulates catecholamine secretion, Pancreastatin tends to influence granule exocytosis and glucose uptake in hepatocytes. Working directly in the laboratory, we see how these differences manifest: cells exposed to Pancreastatin require lower concentrations than its analogs to observe clear metabolic shifts, making purity and stability even more critical for experimental success.
Usage ranges from in vitro cell models with pancreatic islets to in vivo studies in animal models. Many collaborators apply our Pancreastatin in assays that profile signal transduction, exploring PKC and PKA pathways. Some labs use biotinylated or fluorescently labeled versions for receptor binding studies, tracking peptide localization. Our manufacturing protocols allow us to tailor modifications at the N- or C-terminus, based on what the project requires. If a group needs a stable isotope label for mass spectrometry quantification, we integrate that in the synthesis route as well.
Our Pancreastatin peptide most often uses the human 250–301 sequence, but synthesis of rodent or bovine homologs is also common. Over years working directly with tissue banks and academic biochemistry labs, we see requests for truncated, substituted, or amidated variants. Each adjustment can alter both receptor binding and half-life, so our technical team evaluates each project’s needs before starting production. After synthesis, peptides undergo HPLC purification, MALDI-TOF or ESI-MS verification, and amino acid analysis. This workflow reduces batch-to-batch variability and ensures traceability from raw amino acid stock to finished vial.
We pack freshly synthesized Pancreastatin in lyophilized form. Our tests show long-term stability at –20°C, with minimal degradation or oxidation when protected from light and moisture. Reconstitution with sterile water or acetate buffer brings the peptide quickly into solution, ready for use in bioassays or microscopy. Having seen the impact oxygen or repeated freeze–thaw cycles can have on peptide quality, we always advise breaking vials into aliquots after the first dissolve to preserve integrity for multiple uses.
A broad spectrum of Pancreastatin-related peptides can be synthesized with either full-length or region-specific sequences. For labs investigating epitope mapping, internal fragments, truncated chains, or point mutants help pinpoint critical binding sites. Some research projects pivot to murine or bovine analogs, such as the rat Pancreastatin (258–309), because the sequence divergence highlights residues responsible for species-specific functions. These sequence modifications let investigators map not only the conserved roles but also the evolutionary differences in peptide–receptor paring.
Other chromogranin A peptides—like Parastatin, Vasostatin, and Catestatin—flow through similar production pipelines, but their use in experimentation diverges due to distinct biological effects. For example, Vasostatin influences cardiovascular signaling, not islet hormone release. Catestatin suppresses sympathetic nerve activity. Crafting multiple peptides with ultrahigh purity, on matched synthesis platforms, allows research institutions to design head-to-head experiments, helping tease apart overlapping or mutually exclusive signaling roles.
Working with Pancreastatin, the single biggest challenge is always ensuring batch-to-batch reproducibility. Over many years, we have adjusted our process controls and introduced QC checkpoints to minimize any source of variability. Analytical teams compare each batch not just on purity, but also on peptide aggregation, fragment content, and end group chemistry. Pre-shipment, we run side-by-side tests against legacy reference material to ensure experimental users won’t see unexplainable anomalies across projects and time points.
We have helped researchers unravel metabolic pathways by supplying fluorescent or biotin tags at either end of the Pancreastatin sequence. Each coupling method undergoes optimization, as steric hindrance can diminish binding if tags overlap with a receptor-interacting region. Over time, feedback from our partners has shaped which conjugation chemistries we use, often switching suppliers when side reactions risk affecting downstream results. By keeping synthesis and conjugation in house, we control every step—offering documentation for grant and publication needs.
A major distinguishing point for Pancreastatin remains its regulatory impact on glucose transporters and neuroendocrine granule secretion. Unlike bulk signal peptides, Pancreastatin’s biological window is narrower, so impurities or sequence errors carry outsized effects. Even a missing terminal amide can lead to uncharacteristic metabolic profiles in cellular assays. By running mass spectrometry validation for every lot, and rejecting those that miss full-length confirmation, we avoid downstream troubleshooting for research teams.
The sequence and side-chain chemistry also differ sharply from Vasostatin or Secretogranin peptides, which influence immune or cardiovascular responses. Experienced protein chemists on our team have spent years optimizing resin selection and cleavage protocols to prevent side reactions. Each experience with difficult syntheses—pseudoproline insertions, oxidation-prone Cys or Met residues—has created knowledge transfer, so complex custom projects run smoother. Having a stable manufacturing workforce makes it easier to spot process drifts, and solve upstream issues before shipping.
Alongside industrial peptide synthesizers and mass spectrometry, human skill shapes the final product. Veteran organic chemists who monitor each reaction have caught resin compatibility issues that software misses. Peptide synthesis isn’t just about automated machines; it’s about adjusting pH, watching the color of a reaction, and troubleshooting at bench scale before scaling up. Some of our most widely used Pancreastatin batches originated from a revised synthesis where the engineering team swapped coupling agents on the fly to eliminate side-peaks, preserving amino acid integrity.
We share long-term relationships with amino acid suppliers, requesting certification and traceability for all major side-chain groups. Precursor trace contamination—for example, from nickel or other metals—can have outsized effects on peptides involved in receptor binding research. That translates to more work at the quality control stage, but a cleaner, more reproducible end product for the scientific teams relying on our material.
Many research teams come with evolving documentation needs: publications, grant reviews, or IND submissions. We prepare full characterization sheets with HPLC traces, mass spec printouts, and even peptide folding data if needed for specific receptor studies. Having produced Pancreastatin and its analogs for regulatory filings, we know how clean documentation speeds up review and avoids repeated data requests from regulatory agencies or funding bodies. When modifications are introduced—phosphorylation, acetylation, or non-natural amino acids—the paperwork matches each atom introduced.
We never outsource data handling, so cross-checking raw output with technical sheets means no surprises for the end user. By keeping all critical steps in house—down to vial labeling and lyophilization conditions—confidential data linked to novel peptide variants always stays within controlled systems.
Biochemistry researchers and drug developers face an expanding array of experimental models, and peptide requirements keep growing in complexity. Interest in multisite-modified Pancreastatin, stapled peptides, or D-amino acid substitutions reflects new questions about in vivo stability and receptor selectivity. We stay ahead by investing in both the latest peptide synthesizer models and deepening the hands-on knowledge inside our manufacturing team.
Some teams come to us having failed to get comparable activity from overseas suppliers, usually because microheterogeneity or partial sequences undercut reproducibility. By standardizing resin and reagent sources—and by keeping our synthesis at the same facility regardless of project size—our batches remain consistent. A single contaminant peak can derail a year-long research effort, so we maintain rigorous batch retention policies and supply customers with archive samples for independent cross-checks.
Each Pancreastatin order often turns into a long-term dialogue with user labs, as experimenters adjust protocols or run new controls. Our technical team remains available across project timelines, helping troubleshoot solubility, aggregation, or unusual assay cross-reactivity. Based on hundreds of feedback cycles, we have improved refolding protocols and provided custom solubilization instructions for stubborn sequences or conjugated peptides.
Many groups share their published findings with us, letting the manufacturing team see not only the synthetic end point but the biological outcome as well. Uncovering where a slight solubility tweak or tag location impacted a major finding feeds directly back into our production approach. In fields evolving as fast as endocrine peptide research, a manufacturer must remain present not just at the bench, but alongside the research journey itself.
The vast majority of our production goes directly into foundational research, but some Pancreastatin shipments support preclinical formulation studies. Our traceability and documentation practices support both academic and regulated industrial settings. As peptide therapies extend beyond classic hormones, precise manufacturing and sequence fidelity become central not just to publishing, but to advancing new therapeutics toward the clinic.
We strive to maintain open communication with regulatory scientists, journal editors, and end users alike, sharing what our team has learned from thousands of syntheses. Those experiences build the confidence researchers need to choose our Pancreastatin and its related peptides, knowing each batch draws on real human skill, not just machine output.