Contact Us
Lingwu, Yinchuan, Ningxia, China
© 2025 Sinochem Nanjing Corporation, All Right Reserved
|
HS Code |
617875 |
| Product Name | Insulin & Related Peptides |
| Category | Peptide hormones |
| Molecular Formula | C257H383N65O77S6 (for human insulin) |
| Molecular Weight | 5808 Da (for human insulin) |
| Source | Synthetic or recombinant |
| Storage Temperature | -20°C |
| Purity | ≥98% (HPLC) |
| Appearance | White to off-white lyophilized powder |
| Solubility | Soluble in water or dilute acidic solutions |
| Application | Research and pharmaceutical |
| Cas Number | 11061-68-0 |
| Sequence | A chain: GIVEQCCTSICSLYQLENYCN; B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (human insulin) |
| Stability | Stable for at least 12 months at recommended storage |
| Usage | In vitro, in vivo studies and assay development |
| Synonyms | Insulin, Insulin analogs, Peptide hormones |
As an accredited Insulin & Related Peptides factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Insulin & Related Peptides: Supplied in a sealed, amber glass vial containing 10 mg lyophilized powder, labeled for laboratory use. |
| Storage | Insulin and related peptides should be stored at 2–8°C in a refrigerator, protected from light and not frozen. Freezing can denature peptides and reduce their effectiveness. Storage containers should be tightly sealed to prevent contamination. Insulin vials or cartridges should be kept upright, and expired products must be properly disposed of according to local regulations. |
| Shipping | **Shipping for Insulin & Related Peptides**: Insulin and related peptides are shipped in temperature-controlled packaging, typically with ice packs or dry ice, to maintain cold chain integrity. Shipping occurs via overnight or expedited delivery to ensure product stability and potency, and complies with all relevant regulations for biological materials. |
Competitive Insulin & Related Peptides prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please call us at +8615380400285 or mail to admin@sinochem-nanjing.com.
We will respond to you as soon as possible.
Tel: +8615380400285
Email: admin@sinochem-nanjing.com
Lingwu, Yinchuan, Ningxia, China
