Wusu, Tacheng Prefecture, Xinjiang, China sales7@sinochem-nanjing.com 3389378665@qq.com
Follow us:

Insulin & Related Peptides

    • Product Name Insulin & Related Peptides
    • Alias EP1263
    • Einecs 242-362-4
    • Mininmum Order 1 g
    • Factory Site Wusu, Tacheng Prefecture, Xinjiang, China
    • Price Inquiry sales7@sinochem-nanjing.com
    • Manufacturer Sinochem Nanjing Corporation
    • CONTACT NOW
    Specifications

    HS Code

    617875

    Product Name Insulin & Related Peptides
    Category Peptide hormones
    Molecular Formula C257H383N65O77S6 (for human insulin)
    Molecular Weight 5808 Da (for human insulin)
    Source Synthetic or recombinant
    Storage Temperature -20°C
    Purity ≥98% (HPLC)
    Appearance White to off-white lyophilized powder
    Solubility Soluble in water or dilute acidic solutions
    Application Research and pharmaceutical
    Cas Number 11061-68-0
    Sequence A chain: GIVEQCCTSICSLYQLENYCN; B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (human insulin)
    Stability Stable for at least 12 months at recommended storage
    Usage In vitro, in vivo studies and assay development
    Synonyms Insulin, Insulin analogs, Peptide hormones

    As an accredited Insulin & Related Peptides factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Insulin & Related Peptides: Supplied in a sealed, amber glass vial containing 10 mg lyophilized powder, labeled for laboratory use.
    Storage Insulin and related peptides should be stored at 2–8°C in a refrigerator, protected from light and not frozen. Freezing can denature peptides and reduce their effectiveness. Storage containers should be tightly sealed to prevent contamination. Insulin vials or cartridges should be kept upright, and expired products must be properly disposed of according to local regulations.
    Shipping **Shipping for Insulin & Related Peptides**: Insulin and related peptides are shipped in temperature-controlled packaging, typically with ice packs or dry ice, to maintain cold chain integrity. Shipping occurs via overnight or expedited delivery to ensure product stability and potency, and complies with all relevant regulations for biological materials.
    Free Quote

    Competitive Insulin & Related Peptides prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please call us at +8615371019725 or mail to sales7@sinochem-nanjing.com.

    We will respond to you as soon as possible.

    Tel: +8615371019725

    Email: sales7@sinochem-nanjing.com