Tengfei Creation Center,55 Jiangjun Avenue, Jiangning District,Nanjing admin@sinochem-nanjing.com 3389378665@qq.com
Follow us:

Galanins

    • Product Name Galanins
    • Alias GAL
    • Einecs 259-979-8
    • Mininmum Order 1 g
    • Factory Site Tengfei Creation Center,55 Jiangjun Avenue, Jiangning District,Nanjing
    • Price Inquiry admin@sinochem-nanjing.com
    • Manufacturer Sinochem Nanjing Corporation
    • CONTACT NOW
    Specifications

    HS Code

    948279

    Productname Galanins
    Type Neuropeptide
    Molecularweight Approximately 3 kDa
    Aminoacidsequence 29-30 amino acids
    Source Synthesized in neurons
    Function Neurotransmission and neuromodulation
    Receptors GALR1, GALR2, GALR3
    Stability Moderately stable at room temperature
    Solubility Soluble in water and physiological buffer
    Storagetemperature -20°C recommended
    Biologicalactivity Regulation of feeding, pain, mood, and cognition
    Deliveryform Lyophilized powder
    Reconstitution Typically in sterile water
    Usage Research and laboratory use
    Purity ≥95% (HPLC)
    Appearance White to off-white powder

    As an accredited Galanins factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing White, sealed 1 mg vial labeled "Galanins, For Research Use Only," with lot number, expiry date, and chemical structure displayed.
    Shipping Galanins are shipped at ambient temperature, protected from light and moisture, unless specified otherwise by the manufacturer. Packaging ensures secure containment to prevent degradation or contamination. For research use only, they are accompanied by relevant documentation, including Safety Data Sheets (SDS). Expedited and compliant shipping methods are used.
    Storage Galanins are neuropeptides stored primarily in large dense-core vesicles within neurons of the central and peripheral nervous systems. These vesicles protect galanins from degradation and allow their regulated release into synaptic and extracellular spaces upon neuronal stimulation. Storage ensures galanins are readily available for rapid action in modulating neurotransmission, hormone secretion, and various physiological processes.
    Application of Galanins

    Purity 98%: Galanins with purity 98% is used in neuropharmacological studies, where it ensures highly specific receptor activation and reproducible results.

    Molecular Weight 3 kDa: Galanins with molecular weight 3 kDa is used in peptide signaling analysis, where it allows precise identification and mapping of bioactive fragments.

    Stability Temperature 4°C: Galanins with stability temperature of 4°C is used in refrigerated storage for biomedical assays, where it maintains bioactivity and prevents degradation over extended periods.

    Formulation Lyophilized Powder: Galanins in lyophilized powder formulation is used in laboratory experiments, where it enables easy reconstitution and prolonged shelf-life.

    Aqueous Solubility 10 mg/mL: Galanins with aqueous solubility of 10 mg/mL is used in in vitro cell culture applications, where it allows for consistent dosing and uniform distribution.

    HPLC Purity >95%: Galanins with HPLC purity greater than 95% is used in clinical research, where it minimizes impurities and reduces interference in physiological assays.

    Endotoxin Level <0.1 EU/μg: Galanins with endotoxin level less than 0.1 EU/μg is used in immunological testing, where it prevents unwanted activation of immune responses in sensitive assays.

    Peptide Content >90%: Galanins with peptide content greater than 90% is used in drug development pipelines, where it ensures active ingredient efficacy and batch-to-batch consistency.

    Storage pH 5.5-7.0: Galanins stored at pH 5.5-7.0 is used in enzyme-linked immunoassays, where it preserves peptide structure and boosts detection sensitivity.

    Particle Size <5 μm: Galanins with particle size less than 5 μm is used in microinjection studies, where it facilitates accurate delivery and cellular uptake.

    Free Quote

    Competitive Galanins prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please call us at +8615371019725 or mail to admin@sinochem-nanjing.com.

    We will respond to you as soon as possible.

    Tel: +8615371019725

    Email: admin@sinochem-nanjing.com

    Get Free Quote of Sinochem Nanjing Corporation

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    More Introduction

    Introducing Galanins: In-House Manufacturing Expertise

    What Galanins Represent in Modern Peptide Manufacturing

    For years, we have focused on producing peptide solutions that tackle real-world research and development challenges. Among these, Galanins have distinguished themselves for both their biological significance and technical requirements. True to their name, galanins are neuropeptides with established roles in neural signaling, energy metabolism, and pain modulation. Our dedication to manufacturing them springs from an ongoing dialogue with researchers, pharmaceutical developers, and healthcare providers seeking reliability and precision.

    Direct Production, Transparent Standards

    Every batch of Galanin, whether Galanin (human) with the sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, or its rodent analogs, leaves our reactors without intermediaries adding uncertainties to the chain. Peptide synthesis may sound straightforward, but those in the field recognize subtle obstacles: side-chain protection, proper folding, and purity targets above 98%. Our chemists scrutinize every step, not because guidelines say so, but because downstream applications—be it in receptor binding assays or in vivo studies—demand it. Peptides, especially ones prone to aggregation like certain galanins, can deteriorate in transit or storage, and we have honed our lyophilization and cold-chain logistics precisely to retain bioactivity from our facility to your benchtop.

    Model Variants and Specification Benchmarks

    Our portfolio covers galanin 1-29, 2-29, and specialty fragments or analogs relevant to ongoing neuroscience research. Not all projects need the full-length peptide, so fragmentation—such as producing only the bioactive region—is an everyday task. We document sequence fidelity by mass spectrometry, and we use HPLC profiles for every batch. Extending shelf life requires careful stabilization; our team has learned that even minimal deviations in water residue or buffer ions can set off breakdown, so quality means more than a certificate—it means every ampoule matches the reference spectrum and comes from a continuous process improvement cycle.

    Applications and Performance Insights

    Discovery in pain and addiction research, appetite regulation, mood disorder studies, and gastrointestinal pathologies often includes galanin peptides. Our customers, mostly principal investigators in preclinical and translational labs, share that differences in manufacturing show in binding affinity or in inconsistent physiological responses. Faulty batch supply can rip through months of animal studies or cell culture work. By owning the upstream process, we reduce cross-contamination risks (notoriously problematic with highly similar neuropeptides) and verify that each shipment performs as anticipated.

    Differences from Other Products in the Market

    A lot gets lost between manufacturers, resellers, and distributors. Working directly from the lab floor means fewer ambiguous supply-chain steps. There's a marked distinction in what we ship compared to distributor relabels; sometimes those sources don’t even know whether they’re dealing with the same salt form, the same lyophilization protocol, or if a stabilizing excipient got swapped out for a cheaper alternative. We keep extensive documentation on chromatograms, yields, reagent quality, and even supplier audits for the amino acids used in synthesis. Other companies might sell generic “galanin,” but the scientific impact for the researcher depends on what they actually receive.

    Why In-House Production Matters

    Having boots on the factory floor keeps us in tune with the mechanics of each peptide run. Galanin peptides are sensitive to numerous variables, such as temperature during coupling, pH during washing, and cleavage time. Each affects the outcome and reproducibility of biological assays. We have, through trial and error, optimized this over years, listening to partners whose experiments depend on reliable, biologically active material. When early batches showed batch-to-batch purity drift or lower yields, we invested in automated synthesis modules and in-line QA analytics. Routine feedback from users spurred investments in mass spectrometry and real-time peptide analytics instead of relying exclusively on final-batch testing.

    Certainty and Traceability

    Anyone who has dealt with peptide sourcing headaches—off-label substitutions, mixed-origin inventories, mismatched certificates—knows the value of direct accountability. We maintain batch records spanning raw amino acid lots, solvent batches, operator logs, and temperature profiles. Every researcher using our galanins can trace the peptide’s history directly back to a single reactor run. That puts meaningful power into our clients’ hands in the event of troubleshooting experimental outcomes. We welcome questions about synthesis approaches, such as the use of Fmoc- or Boc-strategies, and are frank about the reasoning. For galanins, Fmoc chemistry gives us sharper yields and less byproduct, while side-reactions flagged by our process monitors can be addressed in real time, not after shipping.

    Addressing Real-World Research Challenges

    In academic and industrial labs, time and reproducibility often make or break a project. Galanin peptides affect everything from receptor signaling studies to in vivo models of neurological illness. When labs call about solubility or preparation inconsistencies, they’re not looking for a generic script—they want someone who’s taken the same call dozens of times, run the same batch tests, and seen how freezing, repeated thawing, or resuspension can wreck a peptide’s bioactivity. We optimize packaging and shipping to avoid those pitfalls: low-temperature lyophilized shipment, desiccant tubes, and user-friendly protocols based on direct lab feedback.

    Quality Commitment: Beyond Certificates

    Quality assurance documents are necessary, but scientific reputation depends on repeatable results. Researchers sometimes find variability in animal behavior or receptor binding during galanin studies, only to trace the issue back to inconsistent peptide integrity. By keeping our process internal and open to customer oversight, we invite scrutiny. Every critical control parameter—solvent purity, temperature ramp rates, and cleaning validation—is logged and open to review. In cases where a customer finds a flaw, we trace every step and provide not just restitution, but detailed root-cause explanations drawn from our own production records.

    Direct Feedback and Continuous Improvement

    The best insights often come from the end users of our galanins. Researchers may report issues that no standard specification would flag: subtle shifts in elution times, unexpected mass peaks, cloudiness during dissolution, or alterations in animal response profiles. Every report shapes our next production run. For example, a recurring feedback about peptide clumping at high concentrations led us to optimize carrier salts and re-examine lyophilizing temperatures—a direct adjustment grounded in actual lab observations, not theoretical guides. Scientific manufacturing remains a living process, built on openness, adaptability, and the willingness to learn from every client experience.

    Serving Advanced Research, Not Just Basic Needs

    Drug discovery platforms, diagnostic assay developers, and animal model researchers each need galanin peptides tailored for their goals. Unlike products funneled through generic catalog channels, our batches reflect bespoke adjustments driven by direct scientific conversations. Neurology labs investigating seizure models, endocrinologists studying insulin pathways, or pain researchers modeling nerve injury stand to lose months over a single peptide’s unreliability. Our close connection with these users ensures not just compliant products, but performance that supports their hypotheses.

    Analytical Transparency and User Empowerment

    Our galanin products come with more than just results of standard content assays. We offer chromatograms, full mass spec profiles, and—on request—details about residue-level synthesis steps for customers troubleshooting experimental anomalies. Sometimes a peak in the HPLC trace that regulators might overlook becomes the crucial variable for a lab working at the edge of receptor selectivity. We’re transparent on limits and batch changes, sharing not only what went right but the issues we’ve resolved. In cases of rare sequence analogs or labeled galanin derivatives, the path from initial inquiry to shipment includes planning conversations between production chemists and the research team, so expectations stay real throughout.

    Feel the Difference in Day-to-Day Use

    Repeat clients often remark that setup and prep time vanish when handling our galanins compared to bulk-supplied generics. We hear about clean dissolutions, reproducible responses across batches, and ease in scaling up from bench to process development. These successes trace directly to peptide integrity and batch consistency—outcomes that brewery-like pipelines or anonymous drop-shipping obscure. By holding the keys to our own process, we pass reliability, not just product, to our end users.

    Addressing Variation in Scientific Supply Chains

    Academic and even some commercial labs face unpredictability in peptide sourcing. Say a student orders galanin for a critical project and receives a mixture with inconsistent labeling, or degraded material from improper transport. Small details, such as excess water content or minor buffer shifts, can scuttle months of work. We understand that each experiment rides on invisible details; thus, our production team verifies every single specification—right down to vial capping, desiccant sealing, and label accuracy. These tasks aren’t delegated to outside packagers; they’re handled in-house, by people who know why it counts.

    Meeting Regulatory and Ethical Expectations

    Modern research comes with regulatory scrutiny and an expectation of traceable, ethically produced research materials. Since we manufacture galanins ourselves, we certify both the origins of input materials and the environmental impact of our production, minimizing solvent use and implementing responsible disposal practices. While these measures might seem secondary to peptide quality, sustainable manufacturing practices feed back into the integrity and transparency valued by our customers and their oversight bodies.

    Partnering for Innovation and Rapid Response

    We collaborate with labs running high-throughput screening, custom assay platforms, and those developing galanin analogs for experimental therapy. Fast, flexible, and honest response to new requests shapes the edge we offer. If a research group requests a novel modification or isotopic label, the path from theoretical design to delivered product runs through our own facilities—not diverted to third parties with contradictory standards. This direct link helps reduce lead times and eliminate ambiguity for our partners.

    Ensuring Ethical Use and Documentation

    Transparency extends beyond batch logs. With growing attention on reproducibility and responsible research, clients rely on us for detailed documentation. Peptide production touches many points: animal-free input sourcing, minimized toxic reagents, adherence to fair labor practices, regular third-party audits. Each bottle of galanin represents a complete manufacturing provenance, supporting the values of the scientific community.

    Resolving Challenges in Peptide Research

    Galanin research brings both promise and challenge. Variability in product performance matters in receptor mapping, pain models, or metabolic regulation studies. We see ourselves not just as suppliers but as problem-solvers—fielding calls from researchers encountering preparation issues, unexplained experimental outcomes, or inconsistencies between literature and their own work. In many cases, our deep production history identifies and resolves root causes, turning lost experiments into publishable findings.

    Future Directions and Industry Collaboration

    The study of galanins continues to expand, touching neurodegeneration, cancer, gastrointestinal research, and even immunology. We welcome cutting-edge requests: analogs engineered for receptor selectivity, fluorescent or radiolabeled variants, conjugates intended for novel delivery systems. These projects benefit most from a manufacturer ready to adapt quickly, communicate openly, and stand accountable for every variable. Rapid iteration between bench science and process chemistry gives both us and our partners a competitive advantage.

    Standing Apart: A Commitment to Quality and Community

    Some view peptide manufacturing as a transactional business. We see it as a partnership: shared between us and the diverse community of researchers who drive progress. Our investment in staff training, analytical equipment, workflow refinements, and supply chain ethics underpins every ampoule of galanin that leaves our plant. We talk directly to our users, invite tough conversations, and prioritize results before sales. If something doesn’t work as expected, our first response is to listen and dig into our own logs and processes, bringing the perspective of a peer rather than just a vendor.

    Trust Earned Over Time

    Trust—especially among veteran research teams—builds batch by batch, result by result. We field questions about seemingly minor details: lot-to-lot drift, secondary peaks, reconciliation to literature standards. Years of absorbing and addressing tough feedback have sharpened our process, from small-scale custom batches for a handful of researchers up to recurrent supply for multinational trials. Learning never stops at our facility—as long as science advances, we adapt.

    Your Research, Our Commitment

    Working with galanins isn’t just another line on a catalog. It represents a deeper investment in scientific progress—not just for us, but for every lab depending on reliable, rigorously characterized peptides. The next breakthrough in neuroscience, endocrinology, or biopharma might hinge on the reproducibility and traceability of a single vial. We commit our expertise, transparency, and quality-first mindset so that every batch produced empowers research with integrity.