Tengfei Creation Center,55 Jiangjun Avenue, Jiangning District,Nanjing admin@sinochem-nanjing.com 3389378665@qq.com
Follow us:

Crf (HumanRat) Acetate

    • Product Name Crf (HumanRat) Acetate
    • Alias Crh, Crf, Crf (Human), Crf (Rat), Corticotropin Releasing Factor, Corticotropin Releasing Factor (Crf)
    • Mininmum Order 1 g
    • Factory Site Tengfei Creation Center,55 Jiangjun Avenue, Jiangning District,Nanjing
    • Price Inquiry admin@sinochem-nanjing.com
    • Manufacturer Sinochem Nanjing Corporation
    • CONTACT NOW
    Specifications

    HS Code

    953527

    Product Name Crf (HumanRat) Acetate
    Synonyms Corticotropin-Releasing Factor, CRF
    Species Human, Rat
    Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    Molecular Formula C203H317N55O60S
    Molecular Weight 4757.2 g/mol
    Purity ≥95% (HPLC)
    Appearance White to off-white powder
    Storage Temperature -20°C
    Solubility Soluble in water or sterile saline

    As an accredited Crf (HumanRat) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Crf (Human/Rat) Acetate is supplied in a sterile, sealed 1 mg vial with clear labeling and tamper-evident packaging.
    Shipping Crf (Human/Rat) Acetate is shipped as a lyophilized (freeze-dried) powder in a sealed vial to ensure stability and prevent moisture exposure. The product is typically shipped at ambient temperature but may require cold packs or expedited shipping during warm seasons to maintain quality. Handle in accordance with standard chemical safety procedures.
    Storage Crf (Human/Rat) Acetate should be stored at -20°C, protected from light and moisture. Upon reconstitution, it is recommended to aliquot the solution and store at -20°C or lower for long-term use. Avoid repeated freeze-thaw cycles. The lyophilized form is stable at room temperature for a short period but should be stored desiccated for optimal stability.
    Application of Crf (HumanRat) Acetate

    Purity 98%: Crf (HumanRat) Acetate with purity 98% is used in neuroendocrine research, where it ensures accurate assay results and reproducible experimental data.

    Molecular Weight 4750 Da: Crf (HumanRat) Acetate of molecular weight 4750 Da is used in receptor binding studies, where it provides reliable ligand-receptor affinity measurements.

    Stability Temperature -20°C: Crf (HumanRat) Acetate stored at stability temperature -20°C is used in long-term biobanking, where it maintains structural integrity and bioactivity.

    Peptide Content >90%: Crf (HumanRat) Acetate with peptide content above 90% is used in peptide signaling pathway analysis, where it enhances detection sensitivity and specificity.

    Solubility in Water: Crf (HumanRat) Acetate with high solubility in water is used in in vitro cell culture assays, where it facilitates homogeneous formulation and consistent dosing.

    Endotoxin Level <1 EU/mg: Crf (HumanRat) Acetate with endotoxin level below 1 EU/mg is used in animal model studies, where it minimizes immunogenic interference and inflammatory artifacts.

    Lyophilized Form: Crf (HumanRat) Acetate in lyophilized form is used in stability testing protocols, where it enables extended shelf-life and convenient reconstitution.

    HPLC Purity ≥95%: Crf (HumanRat) Acetate with HPLC purity of at least 95% is used in pharmacological profiling, where it provides high analytical confidence and minimal contamination.

    Free Quote

    Competitive Crf (HumanRat) Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please call us at +8615371019725 or mail to admin@sinochem-nanjing.com.

    We will respond to you as soon as possible.

    Tel: +8615371019725

    Email: admin@sinochem-nanjing.com

    Get Free Quote of Sinochem Nanjing Corporation

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    More Introduction

    Crf (HumanRat) Acetate: Supporting Scientific Discovery with Consistent Quality

    Crafted with Precision for Research Excellence

    Crf (HumanRat) Acetate stands as a result of years spent working directly at the interface of peptide chemistry and biological research. We make this product in our facility, under controlled conditions designed not only for consistency but also for confidence. We understand the weight researchers place on their reagents. Each batch emerges from synthesis, purification, and analytical confirmation under rigorous protocols aligned to current good manufacturing practice. Working hands-on in production, we see the challenges researchers share: batch-to-batch variation, uncertainty about purity, and unpredictable supply timelines. We strive to meet those needs head-on.

    A typical lot of Crf (HumanRat) Acetate is synthesized to a minimum purity of 98% as confirmed by HPLC, with mass spectrometry supporting full sequence integrity. Years of cumulative feedback from research teams taught us that purity alone is not enough. Peptides regularly suffer from issues like incomplete removal of counterions, low solubility, or peptide aggregation. Learning from those realities, we adapted our processes to include extra desalting steps and close monitoring of crucial parameters. As a result, Crf (HumanRat) Acetate not only delivers accurate sequence and expected biological behavior, but also dissolves smoothly in common aqueous buffers used for in vitro or in vivo settings.

    Commitment Born of Daily Laboratory Challenges

    Our clients often work in neuroscience and endocrinology labs, charting novel mechanisms of the human stress response or pharmacological modulation. Decades spent collaborating with these teams exposed us to recurring frustrations: missed experiments because a crucial peptide failed to dissolve, or wasted budget on poor-quality material. These setbacks do not merely slow down progress on paper—they disrupt the real workflow of laboratory teams, wasting irreplaceable time and funding.

    We respond by adjusting real aspects of the manufacturing workflow. For Crf (HumanRat) Acetate, we use solid-phase synthesis, batch-level quality control checkpoints, and careful freezing or lyophilization to preserve sensitive peptide conformations. Direct hands-on control means not cutting corners, always checking chromatograms, and never releasing a shipment until we would be satisfied using it in our own investigations. By monitoring purity at every step with modern instruments, we spot issues such as deletion sequences or incomplete side-chain deprotection, correcting flaws before packaging. Choosing robust acetate salt formation over other forms helps avoid batch crystallization issues detected by many clients using formate or trifluoroacetate variants.

    Details That Make a Difference

    What sets Crf (HumanRat) Acetate apart from commodity imports or generic brands rests in the disciplines we impose inside each production run. Our technicians have trained for years on pH maintenance, peptide-carrier freeze-drying, and small-molecule contaminant identification. We never treat Crf (HumanRat) Acetate as interchangeable with other peptide standards—every sequence modification requires a fresh process validation. These details stem from direct feedback from researchers who reported even minor impurities could yield distinctly different physiological outcomes in test animals.

    One distinct difference from ordinary CRF reagents appears in solubility and ease of handling. Many peptides require extra sonication, pH adjustment, or co-solvents that impair downstream applications. By optimizing acetate counterion balance and lyophilization endpoint, our material rapidly hydrates with gentle agitation alone—making daily lab work less frustrating and result interpretation more straightforward. Ensuring this repeatability took trials with dozens of buffer formulations and multiple rounds of process adjustment.

    Serving Scientists with More Than Just Chemistry

    We once received a panicked call from a graduate student at a partner university. Their experiment depended on rapid delivery and predictable performance of CRF peptide. Our team tracked their shipment through an airline delay, coordinated with customs, and stayed in touch until the researcher confirmed successful peptide reconstitution and bioreactivity from the first vial. That kind of dedication underscores how we fit into the scientific community: we do more than produce, we help troubleshoot and support rapid progress.

    Usage of Crf (HumanRat) Acetate spans cell-based signaling assays, intracerebroventricular injections for rodent stress paradigms, and ELISA standards. Demand frequently comes from projects probing the HPA axis or novel stress hormone modulators. Many clients now specify our acetate-form CRF because they have traced protocol inconsistencies not to operator error or animal variability, but to batch-dependent peptide quality. By logging buffer compatibility, freeze/thaw durability, and trace contaminant stability for each lot, we foster an environment where reproducible research data starts with trustworthy reagents.

    Open Communication Streamlines Innovation

    We believe in a direct two-way connection with every scientist sourcing Crf (HumanRat) Acetate from our facility. Many improvements originate from technical questions or troubleshooting sessions shared by users. Some teams needed advice on storage or reconstitution, others explained problems with common contaminants like TFA or residual resin fragments in peptides from other suppliers. We listen and act—refining purification steps, testing additional sequence verification, and adopting new analytical protocols as science advances.

    A practical example involved a discussion with an investigator encountering variable data between experiments. We walked through their workflow, provided extra analytical data from our end, and jointly identified an incompatibility with a non-standard buffer component. That level of collaboration helps remove mystery from troubleshooting, reduces project delays, and builds relationships grounded in accountability—qualities sometimes overlooked by bulk chemical sellers.

    Clear Value in Application-Focused Chemistry

    Many research teams examine stress hormone response, gene regulation, or brain signaling using Crf (HumanRat) Acetate as an external control or experiment driver. One of the recurring benefits reported traces back to our peptide’s strong signal fidelity in receptor binding studies and dose response curves, compared to cheaper, less-pure analogues. Successful labs attribute reliable downstream data to reagent quality. We insisted on making this peptide at boutique scale, not outsourcing bulk production, so we never lose traceability or compromise on real-time quality tracking.

    We saw, firsthand, how small differences in side-product levels altered biological readouts in stress axis assays. Our investment in multi-stage HPLC purification and in-house analytical chemistry led to an ongoing record of predictable peptide reactivity—backed up by published collaborations between our team and outside laboratories. By holding ourselves to these self-imposed benchmarks, we ensure every vial provides a platform for confident scientific inquiry. We do not offer “off-the-shelf” variability because we subject every lot to targeted, transparent analysis.

    Beyond Chemistry: Reliability, Responsiveness, and Results

    Running a chemical manufacturing line comes with constant pressure: consistency, scalability, and safety. Yet, for research peptides like Crf (HumanRat) Acetate, these factors alone do not guarantee that a batch truly benefits the end user. Every day, our staff review test data, package shipments under tight time windows, and maintain focus on sustainable production. Failures and fixes are openly discussed in morning meetings; quality concerns are met with process tweaks, not excuses. That attitude avoids hidden surprises down the line.

    One essential piece of our reliability derives from full traceability. Every lot receives a unique code tied to synthesis date, raw material source, and full analytical history. Researchers who experience anomalous results have full access to our data so the root cause is never hidden under layers of bureaucracy. That form of transparency strengthens scientific reporting and record-keeping, and doesn’t leave colleagues reporting “source unknown” in publications or grant applications.

    Meeting customer demand means staying ahead on capacity planning. Rather than scaling up beyond our skillset, we planned production runs based on real-world feedback, factoring in seasonal research cycles and critical project deadlines. Knowing the stakes, we build in buffer stock for emergency requests, enabling rapid turnaround without cutting production corners. These hard-earned lessons come not from theory, but from years spent under real pressure.

    Drawing the Line Between Quality and Commodity Peptides

    The market includes a flood of peptides for research use, often manufactured in bulk overseas with little transparency about process controls or verification. Comparing our Crf (HumanRat) Acetate to these offerings, several points stand out. We only release batches after full sequence confirmation, purity verification, and solubility checks. Peptides with TFA counterions carry unwanted acidity and often exhibit inconsistent biological behavior. Our acetate variant reduces such pitfalls by offering chemical stability and predictable pH in mixed buffer applications.

    Researchers sometimes ask if they can substitute our product for peptides available from general distributors. Based on experience, quality gaps quickly emerge in side-by-side tests. Cheaper batches run the risk of high endotoxin levels, sparse documentation, or incomplete removal of synthesis byproducts. Any one of these flaws can lead to failed negative controls, inconsistent standard curves, or even non-specific receptor activation in sensitive models. Beyond paperwork, these issues trace directly to lost research time and funding. We keep controls tight, validation steps thorough, and communication lines open because the science can’t wait for second chances.

    Continuous Learning from End-User Experience

    We invest in the training of our chemists, quality control analysts, and customer support staff. Every improvement in Crf (HumanRat) Acetate production emerged from the open exchange of information between us and research groups. If a lab picks up a trace contaminant in their own analysis, we revisit our internal QC results and update our procedures. This feedback loop drives us to new levels of rigor.

    Our team draws expertise from chemical engineering, analytical chemistry, and hands-on bench science, not from distant boardrooms. By doing so, we match the urgency and precision that top research demands. Laboratories using Crf (HumanRat) Acetate often report greater experimental consistency, which helps them focus on discovery rather than troubleshooting materials. We structure our own lab operations to learn from their challenges and guide continual process improvement.

    Conclusion: Peptide Manufacturing as a Scientific Partnership

    Crf (HumanRat) Acetate leaves our facility as more than a product—it represents the cumulative work of a professional team committed to research progress. Whether used in receptor binding assays, endocrine studies, or pharmacology, its strength lies in origin and transparency. We regard every scientist using this peptide as a partner, working together to move knowledge forward without frustration, ambiguity, or unnecessary hurdles. The journey from synthesis to application involves trust, and we take that trust seriously, every day the production line runs.