Wusu, Tacheng Prefecture, Xinjiang, China sales7@sinochem-nanjing.com 3389378665@qq.com
Follow us:

Crf (HumanRat) Acetate

    • Product Name Crf (HumanRat) Acetate
    • Alias Crh, Crf, Crf (Human), Crf (Rat), Corticotropin Releasing Factor, Corticotropin Releasing Factor (Crf)
    • Mininmum Order 1 g
    • Factory Site Wusu, Tacheng Prefecture, Xinjiang, China
    • Price Inquiry sales7@sinochem-nanjing.com
    • Manufacturer Sinochem Nanjing Corporation
    • CONTACT NOW
    Specifications

    HS Code

    953527

    Product Name Crf (HumanRat) Acetate
    Synonyms Corticotropin-Releasing Factor, CRF
    Species Human, Rat
    Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    Molecular Formula C203H317N55O60S
    Molecular Weight 4757.2 g/mol
    Purity ≥95% (HPLC)
    Appearance White to off-white powder
    Storage Temperature -20°C
    Solubility Soluble in water or sterile saline

    As an accredited Crf (HumanRat) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Crf (Human/Rat) Acetate is supplied in a sterile, sealed 1 mg vial with clear labeling and tamper-evident packaging.
    Storage Crf (Human/Rat) Acetate should be stored at -20°C, protected from light and moisture. Upon reconstitution, it is recommended to aliquot the solution and store at -20°C or lower for long-term use. Avoid repeated freeze-thaw cycles. The lyophilized form is stable at room temperature for a short period but should be stored desiccated for optimal stability.
    Shipping Crf (Human/Rat) Acetate is shipped as a lyophilized (freeze-dried) powder in a sealed vial to ensure stability and prevent moisture exposure. The product is typically shipped at ambient temperature but may require cold packs or expedited shipping during warm seasons to maintain quality. Handle in accordance with standard chemical safety procedures.
    Free Quote

    Competitive Crf (HumanRat) Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please call us at +8615371019725 or mail to sales7@sinochem-nanjing.com.

    We will respond to you as soon as possible.

    Tel: +8615371019725

    Email: sales7@sinochem-nanjing.com