|
HS Code |
953527 |
| Product Name | Crf (HumanRat) Acetate |
| Synonyms | Corticotropin-Releasing Factor, CRF |
| Species | Human, Rat |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Molecular Formula | C203H317N55O60S |
| Molecular Weight | 4757.2 g/mol |
| Purity | ≥95% (HPLC) |
| Appearance | White to off-white powder |
| Storage Temperature | -20°C |
| Solubility | Soluble in water or sterile saline |
As an accredited Crf (HumanRat) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Crf (Human/Rat) Acetate is supplied in a sterile, sealed 1 mg vial with clear labeling and tamper-evident packaging. |
| Shipping | Crf (Human/Rat) Acetate is shipped as a lyophilized (freeze-dried) powder in a sealed vial to ensure stability and prevent moisture exposure. The product is typically shipped at ambient temperature but may require cold packs or expedited shipping during warm seasons to maintain quality. Handle in accordance with standard chemical safety procedures. |
| Storage | Crf (Human/Rat) Acetate should be stored at -20°C, protected from light and moisture. Upon reconstitution, it is recommended to aliquot the solution and store at -20°C or lower for long-term use. Avoid repeated freeze-thaw cycles. The lyophilized form is stable at room temperature for a short period but should be stored desiccated for optimal stability. |
Competitive Crf (HumanRat) Acetate prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please call us at +8615371019725 or mail to admin@sinochem-nanjing.com.
We will respond to you as soon as possible.
Tel: +8615371019725
Email: admin@sinochem-nanjing.com
Flexible payment, competitive price, premium service - Inquire now!